download process
Found in
Documents / eBooks
Business
Educational
eBooks
Movies
Video Tutorials
Music
MP3 (all)
Alternative
Dance, Electronica
Hard Rock
Jazz, Blues, Funk
Pop
Pictures / Graphics
Illustration
Miscellaneous
Nature
Objects
People
Places
Sports
Transportation
Animals
Software / Programs
Business
Miscellaneous
Website Promotion
Graphics Software
Development
PHP
Combination / Misc
Templates / Flash


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Stock Images" downloads in documents / ebooks

Thumbnail 119 Food Stock Images

119 Food Stock Images

This is a collection of 119 HD royalty free stock images all about food. These are a great collection of...

Download
5.00 USD
Thumbnail Ultimate Public Domain Secrets Pack + 2 Mystery BONUSES!

Ultimate Public Domain Secrets Pack + 2 Mystery Bonuses!

Get 4 HOT products on Public Domain, along with two Mystery BONUSES! If you want to make money from public domain,...
1. HowToProfitFromPublicDomain gmgh6mn6.zip
play button

278.507 MB

Download
5.99 USD
Thumbnail Ultimate Product Creation Secrets Pack + 2 Mystery BONUSES!

Ultimate Product Creation Secrets Pack + 2 Mystery Bonuses!

Get 10 HOT products on Product Creation, along with two Mystery BONUSES! If you want to create our own money-making product,...
1. HowToLaunchPLR gg767t4.zip
play button

616.64 MB

Download
14.99 USD

Similar tags: businesscar showclickbankcorvettefitnessimagesmarketingphotophotosprojectsresellerroyalty free stock imagessports carsstockstock imagesstock photosvarious stock imageswebsite Top tags: sound effectsgames shopservice repair manualyamaha