download process
Found in
Documents / eBooks
Business
Manuals & Technical
Entertainment
eBooks
Audio Books / Teaching
Movies
Educational
Video Tutorials
Software / Programs
Business
Website Promotion
Video Tutorials
Development
Templates / Flash


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Viral Video Marketing" downloads in documents / ebooks

Thumbnail Ultimate Viral Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Viral Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Viral Marketing, along with two Mystery BONUSES! If you want to know how generate FREE traffic...
1. Exponential Profit Multiplier with 2 MYSTERY BO...
play button

627.02 MB

Download
15.99 USD
Thumbnail Ultimate Facebook Marketing Secrets Pack2 +2 Mystery BONUSES

Ultimate Facebook Marketing Secrets Pack2 +2 Mystery Bonuses

Get 7 HOT products on Facebook Marketing, along with two Mystery BONUSES! If you want to make money from Facebook marketing,...
1. Facebook Cash Cow+BONUS!
play button

626.43 MB

Download
8.99 USD
Thumbnail The Ultimate Online Marketing Collection - Mrr

The Ultimate Online Marketing Collection - Mrr

This is a collection of the best tools, ebooks, courses, scripts and recourses for online marketers. This package contains over 300...
1. The ultimate traffic guid - drive traffic to yo...
play button

107.187 MB

Download
33.50 USD
Thumbnail Ultimate Niche Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Niche Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Niche Marketing, along with two Mystery BONUSES! If you want to make money from niche marketing,...
1. HowtoArticleDirPLR rkjy5y55.zip
play button

1902.93 MB

Download
12.99 USD
Thumbnail Ultimate Advertising Secrets Pack + 2 Mystery BONUSES!

Ultimate Advertising Secrets Pack + 2 Mystery Bonuses!

Get 5 HOT products on Advertising, along with two Mystery BONUSES! If you want to know how to advertise your products/services...
1. HomeBusinessplr kjd864y55u4.zip
play button

298.04 MB

Download
7.99 USD
Thumbnail Ultimate Video Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Video Marketing Secrets Pack + 2 Mystery Bonuses!

Get 9 HOT products on Video Marketing, along with two Mystery BONUSES! If you want to make money from video marketing,...
1. InternetMarketingAutoPLR ggg655j5j56.zip
play button

607.61 MB

Download
10.99 USD
Thumbnail Ultimate Youtube Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Youtube Marketing Secrets Pack + 2 Mystery Bonuses!

Get 9 HOT products on Youtube Marketing, along with two Mystery BONUSES! Listed below are the 9 products you will get...
1. YouTubeMarketing jtgt56u5u.zip
play button

850.2 MB

Download
9.99 USD
Thumbnail 39 Online Business E-book  Collection

39 Online Business E-book Collection

Get the 39 e-book collection for a very low price. This collection contains the following products: Instant Domain Cash PLR 5 Steps...
1. 5 Steps To Looking 10 Years Younger
play button

563.8 MB

Download
9.95 USD
Thumbnail Indispensable Almanac of Internet Marketing mp3 1,2,3,4,5

Indispensable Almanac Of Internet Marketing Mp3 1,2,3,4,5

This eBook The Indispensable Almanac Of Internet Marketing has been written with one specific purpose in mindto make you aware...
1. Indispensable Almanac of Internet Marketing mp3...
play button

117.741 MB

Download
20.00 USD
Thumbnail Ultimate Wordpress Pack + 2 Mystery BONUSES!

Ultimate Wordpress Pack + 2 Mystery Bonuses!

Get 11 High-Quality Products on Wordpress, along with two Mystery BONUSES! Listed below are the 11 wordpress products you will get...
1. SEO For Wordpress Videos 1 10.zip
play button

4911.33 MB

Download
24.99 USD
Thumbnail Ultimate Networking Marketing Secrets Pack+2 Mystery BONUSES

Ultimate Networking Marketing Secrets Pack+2 Mystery Bonuses

Get 8 HOT products on Networking Marketing, along with two Mystery BONUSES! If you want to make money from networking marketing...
1. NetworkMarketingplr iou7t5r5r5.zip
play button

97.82 MB

Download
10.99 USD
Thumbnail Ultimate Domain Name Marketing Secrets Pack+Mystery BONUSES!

Ultimate Domain Name Marketing Secrets Pack+mystery Bonuses!

Get 4 HOT products on Domain Name Marketing, along with two Mystery BONUSES! If you want to make money from domain...
1. HowSellDomainsEbayPLR 5j57575y.zip
play button

143.03 MB

Download
4.99 USD

Similar tags: cheap ebooksfacebookinstant video marketinginternet marketingmake moneymarketingnichesecretstrafficvideovideo marketingvideo marketing secretsviralviral marketingviral video marketingyoutubeyoutube marketing Top tags: sound effectsgames shopservice repair manualyamaha